ACY1 Antibody - middle region : FITC (ARP75886_P050-FITC)

• Product Number: ARP75886_P050-FITC
• Name: ACY1 Antibody - middle region : FITC (ARP75886_P050-FITC)
• Protein Size (# AA): 373 amino acids
• Molecular Weight: 41kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 95
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: ACY-1, ACY1D, HEL-S-5
• Peptide Sequence: Synthetic peptide located within the following region: FEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: This gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-ACY1 (ARP75886_P050-FITC) antibody is Catalog # AAP75886
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACY1
• Uniprot ID: Q03154-4
• Protein Accession #: NP_001185827
• Purification: Affinity purified
• Gene Symbol: ACY1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: