MARCH8 Antibody - N-terminal region : FITC (ARP75860_P050-FITC)

Data Sheet
 
Product Number ARP75860_P050-FITC
Product Page www.avivasysbio.com/march8-antibody-n-terminal-region-fitc-arp75860-p050-fitc.html
Name MARCH8 Antibody - N-terminal region : FITC (ARP75860_P050-FITC)
Protein Size (# AA) 291 amino acids
Molecular Weight 32kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 220972
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name membrane associated ring-CH-type finger 8
Alias Symbols MIR, CMIR, c-MIR, MARCH8, RNF178, MARCH-VIII
Peptide Sequence Synthetic peptide located within the following region: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010]
Protein Interactions TNFRSF10A; UBC; UBE2H; UBE2D1; TFRC; UBE2D3; IL1RAP; IL1R1; CD86;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-MARCH8 (ARP75860_P050-FITC) antibody
Blocking Peptide For anti-MARCH8 (ARP75860_P050-FITC) antibody is Catalog # AAP75860
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human MARH8
Uniprot ID Q5T0T0
Protein Name E3 ubiquitin-protein ligase MARCH8
Purification Affinity purified
Gene Symbol MARCH8
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com