DNAAF1 Antibody - middle region : FITC (ARP75849_P050-FITC)

• Product Number: ARP75849_P050-FITC
• Name: DNAAF1 Antibody - middle region : FITC (ARP75849_P050-FITC)
• Protein Size (# AA): 418 amino acids
• Molecular Weight: 45kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 123872
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: dynein axonemal assembly factor 1
• Alias Symbols: swt, DAU1, ODA7, CILD13, LRRC50
• Peptide Sequence: Synthetic peptide located within the following region: NLMGNPVIRQIPNYRRTVTVRLKHLTYLDDRPVFPKDRACAEAWARGGYA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: The protein encoded by this gene is cilium-specific and is required for the stability of the ciliary architecture. It is involved in the regulation of microtubule-based cilia and actin-based brush border microvilli. Mutations in this gene are associated with primary ciliary dyskinesia-13. Alternative splicing results in multiple transcript variants.
• Protein Interactions: UBC;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-DNAAF1 (ARP75849_P050-FITC) antibody is Catalog # AAP75849
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DAAF1
• Uniprot ID: Q8NEP3-3
• Protein Name: dynein assembly factor 1, axonemal
• Purification: Affinity purified
• Gene Symbol: DNAAF1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: