HDAC10 Antibody - C-terminal region : FITC (ARP75816_P050-FITC)

• Product Number: ARP75816_P050-FITC
• Name: HDAC10 Antibody - C-terminal region : FITC (ARP75816_P050-FITC)
• Protein Size (# AA): 669 amino acids
• Molecular Weight: 73kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 83933
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: histone deacetylase 10
• Alias Symbols: HD10
• Peptide Sequence: Synthetic peptide located within the following region: SALESIQSARAAQAPHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: The protein encoded by this gene belongs to the histone deacetylase family, members of which deacetylate lysine residues on the N-terminal part of the core histones. Histone deacetylation modulates chromatin structure, and plays an important role in transcriptional regulation, cell cycle progression, and developmental events. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-HDAC10 (ARP75816_P050-FITC) antibody is Catalog # AAP75816
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HDA10
• Uniprot ID: Q969S8
• Protein Name: histone deacetylase 10
• Protein Accession #: NP_114408
• Purification: Affinity purified
• Gene Symbol: HDAC10
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: