| Product Number |
ARP75793_P050-FITC |
| Product Page |
www.avivasysbio.com/wdr26-antibody-c-terminal-region-fitc-arp75793-p050-fitc.html |
| Name |
WDR26 Antibody - C-terminal region : FITC (ARP75793_P050-FITC) |
| Protein Size (# AA) |
661 amino acids |
| Molecular Weight |
72kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
80232 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CDW2, GID7, MIP2, SKDEAS |
| Peptide Sequence |
Synthetic peptide located within the following region: MSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Two transcript variants encoding two different isoforms have been found for this gene. |
| Protein Interactions |
PLCB2; GNB1; Wdr26; PNO1; KCMF1; TSR1; GID8; KIAA0368; RANBP9; RPS26; RPS24; RPS15A; RPS8; RPS7; RPS6; EGFR; SOX2; NPM1; UBC; BARD1; UBE2O; RANBP10; ZNF687; ZNF131; UBD; GNG2; TSG101; ARRB2; UL27; USP46; MAPK6; USP12; UBXN7; FAF2; FAF1; WDR5; CUL4A; CUL4B |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-WDR26 (ARP75793_P050-FITC) antibody |
| Blocking Peptide |
For anti-WDR26 (ARP75793_P050-FITC) antibody is Catalog # AAP75793 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR26 |
| Uniprot ID |
Q9H7D7 |
| Protein Accession # |
NP_079436 |
| Purification |
Affinity purified |
| Gene Symbol |
WDR26 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
