| Product Number |
ARP75793_P050 |
| Product Page |
www.avivasysbio.com/wdr26-antibody-c-terminal-region-arp75793-p050.html |
| Name |
WDR26 Antibody - C-terminal region (ARP75793_P050) |
| Protein Size (# AA) |
661 amino acids |
| Molecular Weight |
72kDa |
| NCBI Gene Id |
80232 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CDW2, GID7, MIP2, SKDEAS |
| Peptide Sequence |
Synthetic peptide located within the following region: MSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Description of Target |
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Two transcript variants encoding two different isoforms have been found for this gene. |
| Protein Interactions |
PLCB2; GNB1; Wdr26; PNO1; KCMF1; TSR1; GID8; KIAA0368; RANBP9; RPS26; RPS24; RPS15A; RPS8; RPS7; RPS6; EGFR; SOX2; NPM1; UBC; BARD1; UBE2O; RANBP10; ZNF687; ZNF131; UBD; GNG2; TSG101; ARRB2; UL27; USP46; MAPK6; USP12; UBXN7; FAF2; FAF1; WDR5; CUL4A; CUL4B |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WDR26 (ARP75793_P050) antibody |
| Blocking Peptide |
For anti-WDR26 (ARP75793_P050) antibody is Catalog # AAP75793 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR26 |
| Uniprot ID |
Q9H7D7 |
| Protein Accession # |
NP_079436 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WDR26 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HCT116 Whole Cell
 | Host: Rabbit
Target Name: WDR26
Sample Type: HCT116 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
