| Product Number |
ARP75764_P050-FITC |
| Product Page |
www.avivasysbio.com/rnaseh2b-antibody-c-terminal-region-fitc-arp75764-p050-fitc.html |
| Name |
RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC) |
| Protein Size (# AA) |
312 amino acids |
| Molecular Weight |
34kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
79621 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ribonuclease H2 subunit B |
| Alias Symbols |
AGS2, DLEU8 |
| Peptide Sequence |
Synthetic peptide located within the following region: SKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). |
| Protein Interactions |
UBC; ANP32E; UBQLN2; RDX; DNAJB1; RNASEH2C; RNASEH2A; NRAS; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-RNASEH2B (ARP75764_P050-FITC) antibody |
| Blocking Peptide |
For anti-RNASEH2B (ARP75764_P050-FITC) antibody is Catalog # AAP75764 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNH2B |
| Uniprot ID |
Q5TBB1 |
| Protein Name |
ribonuclease H2 subunit B |
| Protein Accession # |
NP_078846 |
| Purification |
Affinity purified |
| Gene Symbol |
RNASEH2B |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
