Product Number |
ARP75738_P050-FITC |
Product Page |
www.avivasysbio.com/pdlim2-antibody-c-terminal-region-fitc-arp75738-p050-fitc.html |
Name |
PDLIM2 Antibody - C-terminal region : FITC (ARP75738_P050-FITC) |
Protein Size (# AA) |
278 amino acids |
Molecular Weight |
30kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
64236 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
PDZ and LIM domain 2 |
Alias Symbols |
SLIM, MYSTIQUE |
Peptide Sequence |
Synthetic peptide located within the following region: VLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Protein Interactions |
ACD; POT1; UBC; RELA; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-PDLIM2 (ARP75738_P050-FITC) antibody |
Blocking Peptide |
For anti-PDLIM2 (ARP75738_P050-FITC) antibody is Catalog # AAP75738 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDLI2 |
Uniprot ID |
Q96JY6-4 |
Protein Name |
PDZ and LIM domain protein 2 |
Protein Accession # |
NP_932159 |
Purification |
Affinity purified |
Gene Symbol |
PDLIM2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|