MLST8 Antibody - N-terminal region : FITC (ARP75737_P050-FITC)

Data Sheet
 
Product Number ARP75737_P050-FITC
Product Page www.avivasysbio.com/mlst8-antibody-n-terminal-region-fitc-arp75737-p050-fitc.html
Name MLST8 Antibody - N-terminal region : FITC (ARP75737_P050-FITC)
Protein Size (# AA) 326 amino acids
Molecular Weight 35kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 64223
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MTOR associated protein, LST8 homolog
Alias Symbols GBL, LST8, POP3, WAT1, GbetaL
Peptide Sequence Synthetic peptide located within the following region: TRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Protein Interactions MTOR; EIF4EBP1; RPTOR; AKT1S1; PRR5L; FKBP8; SUZ12; PRMT1; STAT1; RICTOR; UBC; ATXN1; A2M; DEPTOR; ULK1; RPS6KB1; SQSTM1; Cul4a; Dtl; PRR5; CCT2; KRT85; RHEB;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-MLST8 (ARP75737_P050-FITC) antibody
Blocking Peptide For anti-MLST8 (ARP75737_P050-FITC) antibody is Catalog # AAP75737
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human LST8
Uniprot ID Q9BVC4
Protein Name target of rapamycin complex subunit LST8
Purification Affinity purified
Gene Symbol MLST8
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com