PAK6 Antibody - N-terminal region : FITC (ARP75699_P050-FITC)

Data Sheet
 
Product Number ARP75699_P050-FITC
Product Page www.avivasysbio.com/pak6-antibody-n-terminal-region-fitc-arp75699-p050-fitc.html
Name PAK6 Antibody - N-terminal region : FITC (ARP75699_P050-FITC)
Protein Size (# AA) 681 amino acids
Molecular Weight 74kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 56924
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols PAK5
Peptide Sequence Synthetic peptide located within the following region: RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes a member of a family of p21-stimulated serine/threonine protein kinases, which contain an amino-terminal Cdc42/Rac interactive binding (CRIB) domain and a carboxyl-terminal kinase domain. These kinases function in a number of cellular processes, including cytoskeleton rearrangement, apoptosis, and the mitogen-activated protein (MAP) kinase signaling pathway. The protein encoded by this gene interacts with androgen receptor (AR) and translocates to the nucleus, where it is involved in transcriptional regulation. Changes in expression of this gene have been linked to prostate cancer. Alternative splicing results in multiple transcript variants.
Protein Interactions RHOJ; RAC1; NEK6; SEMA3B; TPD52L1; SNX2; HSP90AA1; CDK1; MDM2; AR; APP; LNX1; MYC; MAPK14; CDC42; ESR1; AKT1; YWHAQ;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PAK6 (ARP75699_P050-FITC) antibody
Blocking Peptide For anti-PAK6 (ARP75699_P050-FITC) antibody is Catalog # AAP75699
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAK6
Uniprot ID Q9NQU5
Protein Accession # NP_064553
Purification Affinity purified
Gene Symbol PAK6
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com