KDM4C Antibody - C-terminal region : FITC (ARP75437_P050-FITC)

Data Sheet
 
Product Number ARP75437_P050-FITC
Product Page www.avivasysbio.com/kdm4c-antibody-c-terminal-region-fitc-arp75437-p050-fitc.html
Name KDM4C Antibody - C-terminal region : FITC (ARP75437_P050-FITC)
Protein Size (# AA) 813 amino acids
Molecular Weight 89kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 23081
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols GASC1, JHDM3C, JMJD2C, TDRD14C
Peptide Sequence Synthetic peptide located within the following region: LMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein with one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma. Alternative splicing results in multiple transcript variants.
Protein Interactions UBC; HIST2H3C; HDAC3; PPARG; HDAC1; H3F3A; HIST1H3A; KDM4C; KDM4A;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-KDM4C (ARP75437_P050-FITC) antibody
Blocking Peptide For anti-KDM4C (ARP75437_P050-FITC) antibody is Catalog # AAP75437
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human KDM4C
Uniprot ID Q9H3R0-3
Purification Affinity purified
Gene Symbol KDM4C
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com