DNPH1 Antibody - N-terminal region : FITC (ARP75367_P050-FITC)

Data Sheet
 
Product Number ARP75367_P050-FITC
Product Page www.avivasysbio.com/dnph1-antibody-n-terminal-region-fitc-arp75367-p050-fitc.html
Name DNPH1 Antibody - N-terminal region : FITC (ARP75367_P050-FITC)
Protein Size (# AA) 174 amino acids
Molecular Weight 19kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 10591
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols RCL, C6orf108, dJ330M21.3
Peptide Sequence Synthetic peptide located within the following region: AMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described.
Protein Interactions DNPH1; UBC; PILRA; UBR1; ZNF593; SSU72; DSTN; UBA1; PRDX1; POT1; TERF1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-DNPH1 (ARP75367_P050-FITC) antibody
Blocking Peptide For anti-DNPH1 (ARP75367_P050-FITC) antibody is Catalog # AAP75367
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DNPH1
Uniprot ID O43598
Purification Affinity purified
Gene Symbol DNPH1
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com