PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)

Data Sheet
 
Product Number ARP75320_P050-FITC
Product Page www.avivasysbio.com/pdcd6ip-antibody-c-terminal-region-fitc-arp75320-p050-fitc.html
Name PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)
Protein Size (# AA) 868 amino acids
Molecular Weight 95kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 10015
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name programmed cell death 6 interacting protein
Alias Symbols AIP1, ALIX, HP95, DRIP4
Peptide Sequence Synthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15.
Protein Interactions UBI4; CEP55; UBC; SUMO2; nef; EZH2; IPO9; UBA6; MCTS1; AHCYL1; EZR; UBA1; MAPK1; CHMP4B; gag; UBD; BAG3; RNF11; KEAP1; VCAM1; SH3GL1; CHMP4C; TNIP2; ITGA4; CXCR1; GRB2; HOXA1; PEF1; VPS4B; ABCC1; GPI; PDCD6; F2R; CUL3; ALG2; PTK2B; TUBB; SIRT7; SH3KBP1; C
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PDCD6IP (ARP75320_P050-FITC) antibody
Blocking Peptide For anti-PDCD6IP (ARP75320_P050-FITC) antibody is Catalog # AAP75320
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDC6I
Uniprot ID Q8WUM4
Protein Name programmed cell death 6-interacting protein
Protein Accession # NP_037506
Purification Affinity purified
Gene Symbol PDCD6IP
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com