EMC2 Antibody - N-terminal region : FITC (ARP75278_P050-FITC)

Data Sheet
 
Product Number ARP75278_P050-FITC
Product Page www.avivasysbio.com/emc2-antibody-n-terminal-region-fitc-arp75278-p050-fitc.html
Name EMC2 Antibody - N-terminal region : FITC (ARP75278_P050-FITC)
Protein Size (# AA) 297 amino acids
Molecular Weight 32kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 9694
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols TTC35, KIAA0103
Peptide Sequence Synthetic peptide located within the following region: YDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target The function of this protein remains unknow.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-EMC2 (ARP75278_P050-FITC) antibody
Blocking Peptide For anti-EMC2 (ARP75278_P050-FITC) antibody is Catalog # AAP75278
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMC2
Uniprot ID Q15006
Protein Accession # NP_055488
Purification Affinity purified
Gene Symbol EMC2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com