GPRC5A Antibody - C-terminal region : FITC (ARP75229_P050-FITC)

• Product Number: ARP75229_P050-FITC
• Name: GPRC5A Antibody - C-terminal region : FITC (ARP75229_P050-FITC)
• Protein Size (# AA): 357 amino acids
• Molecular Weight: 39kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 9052
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: G protein-coupled receptor class C group 5 member A
• Alias Symbols: RAI3, TIG1, RAIG1, GPCR5A, PEIG-1
• Peptide Sequence: Synthetic peptide located within the following region: GFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-GPRC5A (ARP75229_P050-FITC) antibody is Catalog # AAP75229
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAI3
• Uniprot ID: Q8NFJ5
• Protein Name: retinoic acid-induced protein 3
• Protein Accession #: NP_003970
• Purification: Affinity purified
• Gene Symbol: GPRC5A
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: