KAT2B Antibody - C-terminal region (ARP75221_P050)

• Product Number: ARP75221_P050
• Name: KAT2B Antibody - C-terminal region (ARP75221_P050)
• Protein Size (# AA): 832 amino acids
• Molecular Weight: 91 kDa
• NCBI Gene Id: 8850
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: lysine acetyltransferase 2B
• Alias Symbols: CAF, PCAF, P/CAF
• Peptide Sequence: Synthetic peptide located within the following region: ESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFME
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KAT2B (ARP75221_P050) antibody is Catalog # AAP75221
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KAT2B
• Uniprot ID: Q92831
• Protein Name: Histone acetyltransferase KAT2B
• Protein Accession #: NP_003875.3
• Purification: Affinity purified
• Nucleotide Accession #: NM_003884.4
• Tested Species Reactivity: Human
• Gene Symbol: KAT2B
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human THP-1 Whole Cell
  
  Host: Rabbit
  Target Name: KAT2B
  Sample Tissue: Human THP-1 Whole Cell lysates
  Antibody Dilution: 1ug/ml