| Product Number |
ARP75210_P050-FITC |
| Product Page |
www.avivasysbio.com/tnfsf11-antibody-c-terminal-region-fitc-arp75210-p050-fitc.html |
| Name |
TNFSF11 Antibody - C-terminal region : FITC (ARP75210_P050-FITC) |
| Protein Size (# AA) |
317 amino acids |
| Molecular Weight |
34kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
8600 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TNF superfamily member 11 |
| Alias Symbols |
ODF, OPGL, sOdf, CD254, OPTB2, RANKL, TNLG6B, TRANCE, hRANKL2 |
| Peptide Sequence |
Synthetic peptide located within the following region: HETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-TNFSF11 (ARP75210_P050-FITC) antibody |
| Blocking Peptide |
For anti-TNFSF11 (ARP75210_P050-FITC) antibody is Catalog # AAP75210 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TNF11 |
| Uniprot ID |
O14788 |
| Protein Name |
tumor necrosis factor ligand superfamily member 11 |
| Purification |
Affinity purified |
| Gene Symbol |
TNFSF11 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
