TRAF5 Antibody - C-terminal region (ARP75163_P050)

• Product Number: ARP75163_P050
• Name: TRAF5 Antibody - C-terminal region (ARP75163_P050)
• Protein Size (# AA): 557 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 7188
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: RNF84, MGC:39780
• Peptide Sequence: Synthetic peptide located within the following region: RQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: N/A
• Description of Target: The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Alternate transcriptional splice variants have been characterized.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRAF5 (ARP75163_P050) antibody is Catalog # AAP75163
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF5
• Uniprot ID: O00463
• Protein Accession #: NP_665702
• Purification: Affinity purified
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: TRAF5
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: TRAF5
  Sample Type: Fetal Lung lysates
  Antibody Dilution: 1.0ug/ml
• Image 2: Mouse Skeletal Muscle
  
  Host: Mouse
  Target Name: TRAF5
  Sample Tissue: Mouse Skeletal Muscle
  Antibody Dilution: 1ug/ml