TRAF3 Antibody - C-terminal region : FITC (ARP75162_P050-FITC)

Data Sheet
 
Product Number ARP75162_P050-FITC
Product Page www.avivasysbio.com/traf3-antibody-c-terminal-region-fitc-arp75162-p050-fitc.html
Name TRAF3 Antibody - C-terminal region : FITC (ARP75162_P050-FITC)
Protein Size (# AA) 485 amino acids
Molecular Weight 53kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 7187
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols CAP1, LAP1, CAP-1, CRAF1, IIAE5, CD40bp, RNF118
Peptide Sequence Synthetic peptide located within the following region: SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-TRAF3 (ARP75162_P050-FITC) antibody
Blocking Peptide For anti-TRAF3 (ARP75162_P050-FITC) antibody is Catalog # AAP75162
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF3
Uniprot ID Q13114-2
Purification Affinity purified
Gene Symbol TRAF3
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com