Product Number |
ARP75162_P050-FITC |
Product Page |
www.avivasysbio.com/traf3-antibody-c-terminal-region-fitc-arp75162-p050-fitc.html |
Name |
TRAF3 Antibody - C-terminal region : FITC (ARP75162_P050-FITC) |
Protein Size (# AA) |
485 amino acids |
Molecular Weight |
53kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
7187 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
CAP1, LAP1, CAP-1, CRAF1, IIAE5, CD40bp, RNF118 |
Peptide Sequence |
Synthetic peptide located within the following region: SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-TRAF3 (ARP75162_P050-FITC) antibody |
Blocking Peptide |
For anti-TRAF3 (ARP75162_P050-FITC) antibody is Catalog # AAP75162 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF3 |
Uniprot ID |
Q13114-2 |
Purification |
Affinity purified |
Gene Symbol |
TRAF3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|