| Product Number |
ARP74924_P050-FITC |
| Product Page |
www.avivasysbio.com/tnfrsf8-antibody-middle-region-fitc-arp74924-p050-fitc.html |
| Name |
TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC) |
| Protein Size (# AA) |
483 amino acids |
| Molecular Weight |
53kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
943 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TNF receptor superfamily member 8 |
| Alias Symbols |
CD30, Ki-1, D1S166E |
| Peptide Sequence |
Synthetic peptide located within the following region: PDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
| Protein Interactions |
UBC; Traf2; Traf1; TRAF5; TRAF3; TNFRSF8; BCL6; TDP2; TNFSF8; ALK; TRAIP; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-TNFRSF8 (ARP74924_P050-FITC) antibody |
| Blocking Peptide |
For anti-TNFRSF8 (ARP74924_P050-FITC) antibody is Catalog # AAP74924 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human TNR8 |
| Uniprot ID |
P28908-3 |
| Protein Name |
tumor necrosis factor receptor superfamily member 8 |
| Protein Accession # |
NP_001268359 |
| Purification |
Affinity purified |
| Gene Symbol |
TNFRSF8 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
