| Product Number |
ARP74850_P050 |
| Product Page |
www.avivasysbio.com/st14-antibody-middle-region-arp74850-p050.html |
| Name |
ST14 Antibody - middle region (ARP74850_P050) |
| Protein Size (# AA) |
855 amino acids |
| Molecular Weight |
94 kDa |
| NCBI Gene Id |
6768 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
suppression of tumorigenicity 14 |
| Alias Symbols |
HAI, CAP3, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14 |
| Peptide Sequence |
Synthetic peptide located within the following region: YRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ST14 (ARP74850_P050) antibody |
| Blocking Peptide |
For anti-ST14 (ARP74850_P050) antibody is Catalog # AAP74850 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ST14 |
| Uniprot ID |
Q9Y5Y6 |
| Protein Name |
Suppressor of tumorigenicity 14 protein |
| Protein Accession # |
NP_068813.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_021978.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ST14 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human A172 Whole Cell
 | Host: Rabbit
Target Name: ST14
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
