| Product Number |
ARP74718_P050 |
| Product Page |
www.avivasysbio.com/pdpk1-antibody-c-terminal-region-arp74718-p050.html |
| Name |
PDPK1 Antibody - C-terminal region (ARP74718_P050) |
| Protein Size (# AA) |
506 amino acids |
| Molecular Weight |
55 kDa |
| NCBI Gene Id |
5170 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
3-phosphoinositide dependent protein kinase 1 |
| Alias Symbols |
PDK1, PDPK2, PDPK2P, PRO0461 |
| Peptide Sequence |
Synthetic peptide located within the following region: LRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PDPK1 (ARP74718_P050) antibody |
| Blocking Peptide |
For anti-PDPK1 (ARP74718_P050) antibody is Catalog # AAP74718 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PDPK1 |
| Uniprot ID |
O15530-2 |
| Protein Name |
3-phosphoinositide-dependent protein kinase 1 |
| Protein Accession # |
NP_001248745.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001261816.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PDPK1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Liver Tumor
 | Host: Rabbit
Target Name: PDPK1
Sample Tissue: Liver Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
