NR1D2 Antibody - N-terminal region : FITC (ARP74677_P050-FITC)

Data Sheet
 
Product Number ARP74677_P050-FITC
Product Page www.avivasysbio.com/nr1d2-antibody-n-terminal-region-fitc-arp74677-p050-fitc.html
Name NR1D2 Antibody - N-terminal region : FITC (ARP74677_P050-FITC)
Protein Size (# AA) 579 amino acids
Molecular Weight 63kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 9975
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols RVR, BD73, EAR-1R, REVERBB, REVERBbeta
Peptide Sequence Synthetic peptide located within the following region: AYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.
Protein Interactions MID2; RBPMS; TRIM27; NOTCH2NL; KRTAP10-9; KRT40; KRTAP4-2; PRMT6; SKP1; UBC; SIN3B; KAT5; NCOR1; TAF9; TAF6; HDAC1; GTF2B; NCOA5; UBE2I; CUL1; NR1D1; RGN;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-NR1D2 (ARP74677_P050-FITC) antibody
Blocking Peptide For anti-NR1D2 (ARP74677_P050-FITC) antibody is Catalog # AAP74677
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human NR1D2
Uniprot ID Q14995
Protein Accession # NP_005117
Purification Affinity purified
Gene Symbol NR1D2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com