NCLN Antibody - N-terminal region : FITC (ARP74659_P050-FITC)

Data Sheet
 
Product Number ARP74659_P050-FITC
Product Page www.avivasysbio.com/ncln-antibody-n-terminal-region-fitc-arp74659-p050-fitc.html
Name NCLN Antibody - N-terminal region : FITC (ARP74659_P050-FITC)
Protein Size (# AA) 563 amino acids
Molecular Weight 61kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 56926
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols NET59
Peptide Sequence Synthetic peptide located within the following region: LPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target NCLN may antagonize Nodal signaling and subsequent organization of axial structures during mesodermal patterning.
Protein Interactions KRTAP5-9; UBC; SUMO1; NEDD8; ILF3; FBXO6; NOMO3; NOMO1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-NCLN (ARP74659_P050-FITC) antibody
Blocking Peptide For anti-NCLN (ARP74659_P050-FITC) antibody is Catalog # AAP74659
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human NCLN
Uniprot ID Q969V3
Purification Affinity purified
Gene Symbol NCLN
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com