Product Number |
ARP74651_P050 |
Product Page |
www.avivasysbio.com/mto1-antibody-c-terminal-region-arp74651-p050.html |
Name |
MTO1 Antibody - C-terminal region (ARP74651_P050) |
Protein Size (# AA) |
595 amino acids |
Molecular Weight |
65 kDa |
NCBI Gene Id |
25821 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
mitochondrial tRNA translation optimization 1 |
Alias Symbols |
CGI-02, COXPD10 |
Peptide Sequence |
Synthetic peptide located within the following region: HFSRPQTIGAASRIPGVTPAAIINLLRFVKTTQRRQSAMNESSKTDQYLC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MTO1 (ARP74651_P050) antibody |
Blocking Peptide |
For anti-MTO1 (ARP74651_P050) antibody is Catalog # AAP74651 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MTO1 |
Uniprot ID |
Q9Y2Z2-2 |
Protein Name |
protein MTO1 homolog, mitochondrial |
Protein Accession # |
NP_001116698.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001123226.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
MTO1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: MTO1 Sample Tissue: 786-0 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|