MTO1 Antibody - C-terminal region (ARP74651_P050)

Data Sheet
 
Product Number ARP74651_P050
Product Page www.avivasysbio.com/mto1-antibody-c-terminal-region-arp74651-p050.html
Name MTO1 Antibody - C-terminal region (ARP74651_P050)
Protein Size (# AA) 595 amino acids
Molecular Weight 65 kDa
NCBI Gene Id 25821
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name mitochondrial tRNA translation optimization 1
Alias Symbols CGI-02, COXPD10
Peptide Sequence Synthetic peptide located within the following region: HFSRPQTIGAASRIPGVTPAAIINLLRFVKTTQRRQSAMNESSKTDQYLC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MTO1 (ARP74651_P050) antibody
Blocking Peptide For anti-MTO1 (ARP74651_P050) antibody is Catalog # AAP74651
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MTO1
Uniprot ID Q9Y2Z2-2
Protein Name protein MTO1 homolog, mitochondrial
Protein Accession # NP_001116698.1
Purification Affinity purified
Nucleotide Accession # NM_001123226.1
Tested Species Reactivity Human
Gene Symbol MTO1
Predicted Species Reactivity Human
Application WB
Image 1
Human 786-0 Whole Cell
Host: Rabbit
Target Name: MTO1
Sample Tissue: 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com