MMP7 Antibody - C-terminal region : FITC (ARP74644_P050-FITC)

Data Sheet
 
Product Number ARP74644_P050-FITC
Product Page www.avivasysbio.com/mmp7-antibody-c-terminal-region-fitc-arp74644-p050-fitc.html
Name MMP7 Antibody - C-terminal region : FITC (ARP74644_P050-FITC)
Protein Size (# AA) 267 amino acids
Molecular Weight 29kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 4316
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols MMP-7, MPSL1, PUMP-1
Peptide Sequence Synthetic peptide located within the following region: THELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Protein Interactions NGF; TNFSF11; CD151; BCAN; SERPINA1; PLG; SPP1; MBP; TFPI; FASLG; HBEGF; DCN; MMP9; MMP1; HAPLN1; CD44; ZBTB33;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-MMP7 (ARP74644_P050-FITC) antibody
Blocking Peptide For anti-MMP7 (ARP74644_P050-FITC) antibody is Catalog # AAP74644
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MMP7
Uniprot ID P09237
Protein Accession # NP_002414
Purification Affinity Purified
Gene Symbol MMP7
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com