| Product Number |
ARP74544_P050 |
| Product Page |
www.avivasysbio.com/gnb1l-antibody-n-terminal-region-arp74544-p050.html |
| Name |
GNB1L Antibody - N-terminal region (ARP74544_P050) |
| Protein Size (# AA) |
327 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
54584 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
guanine nucleotide binding protein (G protein), beta polypeptide 1-like |
| Alias Symbols |
GY2, FKSG1, WDR14, WDVCF, DGCRK3 |
| Peptide Sequence |
Synthetic peptide located within the following region: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders. Transcripts from this gene share exons with some transcripts from the C22orf29 gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GNB1L (ARP74544_P050) antibody |
| Blocking Peptide |
For anti-GNB1L (ARP74544_P050) antibody is Catalog # AAP74544 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GNB1L |
| Uniprot ID |
Q9BYB4 |
| Protein Name |
guanine nucleotide-binding protein subunit beta-like protein 1 |
| Protein Accession # |
NP_443730.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_053004.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GNB1L |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: GNB1L
Sample Tissue: Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
