DDX1 Antibody - middle region : FITC (ARP74479_P050-FITC)

Data Sheet
 
Product Number ARP74479_P050-FITC
Product Page www.avivasysbio.com/ddx1-antibody-middle-region-fitc-arp74479-p050-fitc.html
Name DDX1 Antibody - middle region : FITC (ARP74479_P050-FITC)
Protein Size (# AA) 740 amino acids
Molecular Weight 81kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 1653
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols DBP-RB, UKVH5d
Peptide Sequence Synthetic peptide located within the following region: TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
Protein Interactions HUWE1; FUS; SUMO2; SUMO3; STAU1; UBC; SUMO1; NEDD8; Fbxl16; WWOX; ZBTB1; RPA3; RPA2; RPA1; rev; C14orf166; RTCB; RPL26L1; EIF3K; NELFB; EDC4; IGF2BP3; PDCD6; ABCF1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; YBX1; NMT1; HNRNPM; MRE11A; KRT18; ILF2; HN
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-DDX1 (ARP74479_P050-FITC) antibody
Blocking Peptide For anti-DDX1 (ARP74479_P050-FITC) antibody is Catalog # AAP74479
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human DDX1
Uniprot ID Q92499
Protein Accession # NP_004930
Purification Affinity Purified
Gene Symbol DDX1
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com