DDX1 Antibody - middle region (ARP74479_P050)

Data Sheet
 
Product Number ARP74479_P050
Product Page www.avivasysbio.com/ddx1-antibody-middle-region-arp74479-p050.html
Name DDX1 Antibody - middle region (ARP74479_P050)
Protein Size (# AA) 740 amino acids
Molecular Weight 81kDa
NCBI Gene Id 1653
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols DBP-RB, UKVH5d
Peptide Sequence Synthetic peptide located within the following region: TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
Protein Interactions HUWE1; FUS; SUMO2; SUMO3; STAU1; UBC; SUMO1; NEDD8; Fbxl16; WWOX; ZBTB1; RPA3; RPA2; RPA1; rev; C14orf166; RTCB; RPL26L1; EIF3K; NELFB; EDC4; IGF2BP3; PDCD6; ABCF1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; YBX1; NMT1; HNRNPM; MRE11A; KRT18; ILF2; HN
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDX1 (ARP74479_P050) antibody
Blocking Peptide For anti-DDX1 (ARP74479_P050) antibody is Catalog # AAP74479
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human DDX1
Uniprot ID Q92499
Protein Accession # NP_004930
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol DDX1
Predicted Species Reactivity Human
Application WB
Image 1
Human 721_B Whole Cell
Host: Rabbit
Target Name: DDX1
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com