AMHR2 Antibody - N-terminal region : FITC (ARP74381_P050-FITC)

Data Sheet
 
Product Number ARP74381_P050-FITC
Product Page www.avivasysbio.com/amhr2-antibody-n-terminal-region-fitc-arp74381-p050-fitc.html
Name AMHR2 Antibody - N-terminal region : FITC (ARP74381_P050-FITC)
Protein Size (# AA) 573 amino acids
Molecular Weight 63kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 269
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols AMHR, MRII, MISR2, MISRII
Peptide Sequence Synthetic peptide located within the following region: VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Interactions HSP90AA1; PTEN; BMPR1B; AMH; TGFBR1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-AMHR2 (ARP74381_P050-FITC) antibody
Blocking Peptide For anti-AMHR2 (ARP74381_P050-FITC) antibody is Catalog # AAP74381
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMHR2
Uniprot ID Q16671
Protein Accession # NP_065434
Purification Affinity Purified
Gene Symbol AMHR2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com