Product Number |
ARP74381_P050-FITC |
Product Page |
www.avivasysbio.com/amhr2-antibody-n-terminal-region-fitc-arp74381-p050-fitc.html |
Name |
AMHR2 Antibody - N-terminal region : FITC (ARP74381_P050-FITC) |
Protein Size (# AA) |
573 amino acids |
Molecular Weight |
63kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
269 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
AMHR, MRII, MISR2, MISRII |
Peptide Sequence |
Synthetic peptide located within the following region: VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Protein Interactions |
HSP90AA1; PTEN; BMPR1B; AMH; TGFBR1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-AMHR2 (ARP74381_P050-FITC) antibody |
Blocking Peptide |
For anti-AMHR2 (ARP74381_P050-FITC) antibody is Catalog # AAP74381 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMHR2 |
Uniprot ID |
Q16671 |
Protein Accession # |
NP_065434 |
Purification |
Affinity Purified |
Gene Symbol |
AMHR2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|