Product Number |
ARP74277_P050 |
Product Page |
www.avivasysbio.com/taz-antibody-middle-region-arp74277-p050.html |
Name |
TAZ Antibody - middle region (ARP74277_P050) |
Protein Size (# AA) |
292 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
6901 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
EFE, TAZ, BTHS, EFE2, G4.5, Taz1, CMD3A, LVNCX |
Peptide Sequence |
Synthetic peptide located within the following region: LHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. |
Protein Interactions |
LATS2; CSNK1E; CHGB; LATS1; BTRC; STK3; UBC; GSK3B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TAZ (ARP74277_P050) antibody |
Blocking Peptide |
For anti-TAZ (ARP74277_P050) antibody is Catalog # AAP74277 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human TAZ |
Uniprot ID |
Q16635 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
TAZ |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Fetal Lung
| Host: Rabbit Target Name: TAZ Sample Type: Fetal Lung lysates Antibody Dilution: 1.0ug/ml |
|
|