TAZ Antibody - middle region (ARP74277_P050)

Data Sheet
 
Product Number ARP74277_P050
Product Page www.avivasysbio.com/taz-antibody-middle-region-arp74277-p050.html
Name TAZ Antibody - middle region (ARP74277_P050)
Protein Size (# AA) 292 amino acids
Molecular Weight 32kDa
NCBI Gene Id 6901
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols EFE, TAZ, BTHS, EFE2, G4.5, Taz1, CMD3A, LVNCX
Peptide Sequence Synthetic peptide located within the following region: LHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Protein Interactions LATS2; CSNK1E; CHGB; LATS1; BTRC; STK3; UBC; GSK3B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAZ (ARP74277_P050) antibody
Blocking Peptide For anti-TAZ (ARP74277_P050) antibody is Catalog # AAP74277
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human TAZ
Uniprot ID Q16635
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol TAZ
Predicted Species Reactivity Human
Application WB
Image 1
Human Fetal Lung
Host: Rabbit
Target Name: TAZ
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com