STAP2 Antibody - N-terminal region : FITC (ARP74268_P050-FITC)

• Product Number: ARP74268_P050-FITC
• Name: STAP2 Antibody - N-terminal region : FITC (ARP74268_P050-FITC)
• Protein Size (# AA): 403 amino acids
• Molecular Weight: 44kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 55620
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: BKS
• Peptide Sequence: Synthetic peptide located within the following region: DFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLEC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.
• Protein Interactions: Dlg4; MLH1; MYD88; IKBKB; CHUK; PTK2; CSF1R; CBL; STAT5B; PTK6; STAT5A; SRC; JAK2; BMP4; STAT3;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-STAP2 (ARP74268_P050-FITC) antibody is Catalog # AAP74268
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAP2
• Uniprot ID: Q9UGK3
• Purification: Affinity purified
• Gene Symbol: STAP2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: