STAP2 Antibody - N-terminal region (ARP74268_P050)

Data Sheet
 
Product Number ARP74268_P050
Product Page www.avivasysbio.com/stap2-antibody-n-terminal-region-arp74268-p050.html
Name STAP2 Antibody - N-terminal region (ARP74268_P050)
Protein Size (# AA) 403 amino acids
Molecular Weight 44kDa
NCBI Gene Id 55620
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols BKS
Peptide Sequence Synthetic peptide located within the following region: DFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLEC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference N/A
Description of Target This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.
Protein Interactions Dlg4; MLH1; MYD88; IKBKB; CHUK; PTK2; CSF1R; CBL; STAT5B; PTK6; STAT5A; SRC; JAK2; BMP4; STAT3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-STAP2 (ARP74268_P050) antibody
Blocking Peptide For anti-STAP2 (ARP74268_P050) antibody is Catalog # AAP74268
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAP2
Uniprot ID Q9UGK3
Purification Affinity purified
Tested Species Reactivity Human
Gene Symbol STAP2
Predicted Species Reactivity Human
Application WB
Image 1
Human Fetal Lung
Host: Rabbit
Target Name: STAP2
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com