| Product Number |
ARP74257_P050-FITC |
| Product Page |
www.avivasysbio.com/sox4-antibody-n-terminal-region-fitc-arp74257-p050-fitc.html |
| Name |
SOX4 Antibody - N-terminal region : FITC (ARP74257_P050-FITC) |
| Protein Size (# AA) |
474 amino acids |
| Molecular Weight |
52kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
6659 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CSS10, EVI16 |
| Peptide Sequence |
Synthetic peptide located within the following region: KRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. |
| Protein Interactions |
TAF5; UBE2I; ELAVL1; TP53; MDM2; EP300; tat; SDCBP; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX4 (ARP74257_P050-FITC) antibody |
| Blocking Peptide |
For anti-SOX4 (ARP74257_P050-FITC) antibody is Catalog # AAP74257 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX4 |
| Uniprot ID |
Q06945 |
| Protein Accession # |
NP_003098 |
| Purification |
Affinity Purified |
| Gene Symbol |
SOX4 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
