| Product Number |
ARP74231_P050-FITC |
| Product Page |
www.avivasysbio.com/slc35d1-antibody-c-terminal-region-fitc-arp74231-p050-fitc.html |
| Name |
SLC35D1 Antibody - C-terminal region : FITC (ARP74231_P050-FITC) |
| Protein Size (# AA) |
355 amino acids |
| Molecular Weight |
39kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
23169 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
solute carrier family 35 member D1 |
| Alias Symbols |
SHNKND, UGTREL7 |
| Peptide Sequence |
Synthetic peptide located within the following region: GGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
Glycosylation of cellular glycoconjugates occurs in the endoplasmic reticulum (ER) and Golgi compartment, and requires transport of nucleotide sugars from the cytosol into the lumen of the ER and Golgi by specific transporters. The protein encoded by this gene resides in the ER, and transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm to the ER lumen. It may participate in glucuronidation and/or chondroitin sulfate biosynthesis. Mutations in this gene are associated with Schneckenbecken dysplasia. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC35D1 (ARP74231_P050-FITC) antibody |
| Blocking Peptide |
For anti-SLC35D1 (ARP74231_P050-FITC) antibody is Catalog # AAP74231 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human S35D1 |
| Uniprot ID |
Q9NTN3 |
| Protein Name |
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter |
| Protein Accession # |
NP_055954 |
| Purification |
Affinity Purified |
| Gene Symbol |
SLC35D1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
