RUNX3 Antibody - C-terminal region : FITC (ARP74196_P050-FITC)

Data Sheet
 
Product Number ARP74196_P050-FITC
Product Page www.avivasysbio.com/runx3-antibody-c-terminal-region-fitc-arp74196-p050-fitc.html
Name RUNX3 Antibody - C-terminal region : FITC (ARP74196_P050-FITC)
Protein Size (# AA) 415 amino acids
Molecular Weight 45kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 864
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols AML2, CBFA3, PEBP2aC
Peptide Sequence Synthetic peptide located within the following region: PQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Interactions Dlg4; UBC; PML; PIN1; NOTCH1; RBPJ; SIRT2; Cdk4; MDM2; EZH2; Vdr; SMURF2; SMURF1; HDAC9; SUV39H1; SMAD3; EP300; CBFB; SP110; HDAC5; HDAC4; HDAC2; HDAC1; TLE1; SMAD1; YAP1; SMAD5; SMAD2; PHB2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-RUNX3 (ARP74196_P050-FITC) antibody
Blocking Peptide For anti-RUNX3 (ARP74196_P050-FITC) antibody is Catalog # AAP74196
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RUNX3
Uniprot ID Q13761
Purification Affinity purified
Gene Symbol RUNX3
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com