| Product Number |
ARP74191_P050-FITC |
| Product Page |
www.avivasysbio.com/rps19-antibody-c-terminal-region-fitc-arp74191-p050-fitc.html |
| Name |
RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC) |
| Protein Size (# AA) |
145 amino acids |
| Molecular Weight |
15kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
6223 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ribosomal protein S19 |
| Alias Symbols |
DBA, S19, DBA1, eS19, LOH19CR1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19E family of ribosomal proteins. It is located in the cytoplasm. Mutations in this gene cause Diamond-Blackfan anemia (DBA), a constitutional erythroblastopenia characterized by absent or decreased erythroid precursors, in a subset of patients. This suggests a possible extra-ribosomal function for this gene in erythropoietic differentiation and proliferation, in addition to its ribosomal function. Higher expression levels of this gene in some primary colon carcinomas compared to matched normal colon tissues has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Protein Interactions |
TP53; HUWE1; CEP250; NEDD1; TUBGCP4; TUBGCP2; PPP2R1A; AURKA; UBC; MDM2; RPS17; RNF2; WIBG; EIF2A; TSR1; SERBP1; EIF3E; FAU; RPS29; RPS28; RPS26; RPS25; RPS24; RPS23; RPS20; RPS18; RPS16; RPS15A; RPS15; RPS14; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-RPS19 (ARP74191_P050-FITC) antibody |
| Blocking Peptide |
For anti-RPS19 (ARP74191_P050-FITC) antibody is Catalog # AAP74191 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RS19 |
| Uniprot ID |
P39019 |
| Protein Name |
40S ribosomal protein S19 |
| Protein Accession # |
NP_001013 |
| Purification |
Affinity Purified |
| Gene Symbol |
RPS19 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
