PYGM Antibody - C-terminal region : FITC (ARP74158_P050-FITC)

Data Sheet
 
Product Number ARP74158_P050-FITC
Product Page www.avivasysbio.com/pygm-antibody-c-terminal-region-fitc-arp74158-p050-fitc.html
Name PYGM Antibody - C-terminal region : FITC (ARP74158_P050-FITC)
Protein Size (# AA) 754 amino acids
Molecular Weight 82kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 5837
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols GSD5
Peptide Sequence Synthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Protein Interactions WDYHV1; PRKAB2; UBC; S100A1; TOP1; PPP2R5A; Ccdc15; PYGM; TRIM63; PACSIN3; DEGS1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PYGM (ARP74158_P050-FITC) antibody
Blocking Peptide For anti-PYGM (ARP74158_P050-FITC) antibody is Catalog # AAP74158
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PYGM
Uniprot ID P11217-2
Purification Affinity Purified
Gene Symbol PYGM
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com