PYGM Antibody - C-terminal region (ARP74158_P050)

Data Sheet
 
Product Number ARP74158_P050
Product Page www.avivasysbio.com/pygm-antibody-c-terminal-region-arp74158-p050.html
Name PYGM Antibody - C-terminal region (ARP74158_P050)
Protein Size (# AA) 754 amino acids
Molecular Weight 82kDa
NCBI Gene Id 5837
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols GSD5
Peptide Sequence Synthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Protein Interactions WDYHV1; PRKAB2; UBC; S100A1; TOP1; PPP2R5A; Ccdc15; PYGM; TRIM63; PACSIN3; DEGS1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PYGM (ARP74158_P050) antibody
Blocking Peptide For anti-PYGM (ARP74158_P050) antibody is Catalog # AAP74158
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PYGM
Uniprot ID P11217-2
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol PYGM
Predicted Species Reactivity Human
Application WB
Image 1
Human Hela Whole Cell
Host: Rabbit
Target Name: PYGM
Sample Type: Hela Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com