| Product Number |
ARP74151_P050 |
| Product Page |
www.avivasysbio.com/prpf4-antibody-middle-region-arp74151-p050.html |
| Name |
PRPF4 Antibody - middle region (ARP74151_P050) |
| Protein Size (# AA) |
57 amino acids |
| Molecular Weight |
522 |
| NCBI Gene Id |
9128 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
PRPF4 |
| Alias Symbols |
PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60 |
| Peptide Sequence |
Synthetic peptide located within the following region: RERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is part of a heteromeric complex that binds U4, U5, and U6 small nuclear RNAs and is involved in pre-mRNA splicing. The encoded protein also is a mitotic checkpoint protein and a regulator of chemoresistance in human ovarian cancer. Two transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PRPF4 (ARP74151_P050) antibody |
| Blocking Peptide |
For anti-PRPF4 (ARP74151_P050) antibody is Catalog # AAP74151 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PRPF4 |
| Uniprot ID |
O43172 |
| Protein Name |
U4/U6 small nuclear ribonucleoprotein Prp4 |
| Protein Accession # |
NP_004688.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001244926.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PRPF4 |
| Application |
WB |
| Image 1 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: PRPF4
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
