PAPSS2 Antibody - C-terminal region : FITC (ARP74113_P050-FITC)

Data Sheet
 
Product Number ARP74113_P050-FITC
Product Page www.avivasysbio.com/papss2-antibody-c-terminal-region-fitc-arp74113-p050-fitc.html
Name PAPSS2 Antibody - C-terminal region : FITC (ARP74113_P050-FITC)
Protein Size (# AA) 614 amino acids
Molecular Weight 67kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 9060
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Alias Symbols SK2, BCYM4, ATPSK2
Peptide Sequence Synthetic peptide located within the following region: MIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Protein Interactions RIC8A; ARIH2; GTF3C4; TXNRD1; TUBB2A; HNRNPA2B1; APEX1; UBD; UBC; APP; Papss1; VHL;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PAPSS2 (ARP74113_P050-FITC) antibody
Blocking Peptide For anti-PAPSS2 (ARP74113_P050-FITC) antibody is Catalog # AAP74113
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAPS2
Uniprot ID O95340
Protein Name bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Protein Accession # NP_004661
Purification Affinity Purified
Gene Symbol PAPSS2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com