MELK Antibody - middle region (ARP74061_P050)

Data Sheet
 
Product Number ARP74061_P050
Product Page www.avivasysbio.com/melk-antibody-middle-region-arp74061-p050.html
Name MELK Antibody - middle region (ARP74061_P050)
Protein Size (# AA) 457 amino acids
Molecular Weight 50kDa
NCBI Gene Id 9833
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols HPK38
Peptide Sequence Synthetic peptide located within the following region: MEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference N/A
Description of Target MELK is a serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. It acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. And it plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. It may also play a role in primitive hematopoiesis.
Protein Interactions UBC; YGR054W; Acaca; CSN1S1; MELK; MBP; LMNB1; BABAM1; ZNF622; SF3B1; EIF2S1; CDC5L; PPP1R8; HIST1H1B; CDC25B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MELK (ARP74061_P050) antibody
Blocking Peptide For anti-MELK (ARP74061_P050) antibody is Catalog # AAP74061
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MELK
Uniprot ID Q14680-3
Purification Affinity purified
Tested Species Reactivity Human
Gene Symbol MELK
Predicted Species Reactivity Human
Application WB
Image 1
Human A549 Whole Cell
Host: Rabbit
Target Name: MELK
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com