LOXL2 Antibody - C-terminal region : FITC (ARP74037_P050-FITC)

Data Sheet
 
Product Number ARP74037_P050-FITC
Product Page www.avivasysbio.com/loxl2-antibody-c-terminal-region-fitc-arp74037-p050-fitc.html
Name LOXL2 Antibody - C-terminal region : FITC (ARP74037_P050-FITC)
Protein Size (# AA) 774 amino acids
Molecular Weight 85kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 4017
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols LOR, LOR2, WS9-14
Peptide Sequence Synthetic peptide located within the following region: MEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
Protein Interactions UBC; SUMO1; PDIA3;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-LOXL2 (ARP74037_P050-FITC) antibody
Blocking Peptide For anti-LOXL2 (ARP74037_P050-FITC) antibody is Catalog # AAP74037
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LOXL2
Uniprot ID Q9Y4K0
Protein Accession # NP_002309
Purification Affinity Purified
Gene Symbol LOXL2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com