Product Number |
ARP74037_P050-FITC |
Product Page |
www.avivasysbio.com/loxl2-antibody-c-terminal-region-fitc-arp74037-p050-fitc.html |
Name |
LOXL2 Antibody - C-terminal region : FITC (ARP74037_P050-FITC) |
Protein Size (# AA) |
774 amino acids |
Molecular Weight |
85kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
4017 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
LOR, LOR2, WS9-14 |
Peptide Sequence |
Synthetic peptide located within the following region: MEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. |
Protein Interactions |
UBC; SUMO1; PDIA3; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-LOXL2 (ARP74037_P050-FITC) antibody |
Blocking Peptide |
For anti-LOXL2 (ARP74037_P050-FITC) antibody is Catalog # AAP74037 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LOXL2 |
Uniprot ID |
Q9Y4K0 |
Protein Accession # |
NP_002309 |
Purification |
Affinity Purified |
Gene Symbol |
LOXL2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|