Product Number |
ARP74037_P050 |
Product Page |
www.avivasysbio.com/loxl2-antibody-c-terminal-region-arp74037-p050.html |
Name |
LOXL2 Antibody - C-terminal region (ARP74037_P050) |
Protein Size (# AA) |
774 amino acids |
Molecular Weight |
85kDa |
NCBI Gene Id |
4017 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
LOR, LOR2, WS9-14 |
Peptide Sequence |
Synthetic peptide located within the following region: MEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. |
Protein Interactions |
UBC; SUMO1; PDIA3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LOXL2 (ARP74037_P050) antibody |
Blocking Peptide |
For anti-LOXL2 (ARP74037_P050) antibody is Catalog # AAP74037 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LOXL2 |
Uniprot ID |
Q9Y4K0 |
Protein Accession # |
NP_002309 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
LOXL2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human HepG2 Whole Cell
| Host: Rabbit Target Name: LOXL2 Sample Type: HepG2 Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|