LOXL2 Antibody - C-terminal region (ARP74037_P050)

Data Sheet
 
Product Number ARP74037_P050
Product Page www.avivasysbio.com/loxl2-antibody-c-terminal-region-arp74037-p050.html
Name LOXL2 Antibody - C-terminal region (ARP74037_P050)
Protein Size (# AA) 774 amino acids
Molecular Weight 85kDa
NCBI Gene Id 4017
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols LOR, LOR2, WS9-14
Peptide Sequence Synthetic peptide located within the following region: MEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
Protein Interactions UBC; SUMO1; PDIA3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LOXL2 (ARP74037_P050) antibody
Blocking Peptide For anti-LOXL2 (ARP74037_P050) antibody is Catalog # AAP74037
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LOXL2
Uniprot ID Q9Y4K0
Protein Accession # NP_002309
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol LOXL2
Predicted Species Reactivity Human
Application WB
Image 1
Human HepG2 Whole Cell
Host: Rabbit
Target Name: LOXL2
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com