LDB1 Antibody - C-terminal region : FITC (ARP74027_P050-FITC)

Data Sheet
 
Product Number ARP74027_P050-FITC
Product Page www.avivasysbio.com/ldb1-antibody-c-terminal-region-fitc-arp74027-p050-fitc.html
Name LDB1 Antibody - C-terminal region : FITC (ARP74027_P050-FITC)
Protein Size (# AA) 411 amino acids
Molecular Weight 45kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 8861
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols NLI, CLIM2, LDB-1, CLIM-2
Peptide Sequence Synthetic peptide located within the following region: VAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target LDB1 binds to the LIM domain of a wide variety of LIM domain- containing transcription factors. It may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. It acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state.
Protein Interactions LHX8; LHX6; SSBP3; LMO4; LMX1B; LMO2; LMO1; POLR1B; LSM7; IRAK3; UBC; PSMD10; PSMA1; TRIM33; ATXN1; RNF38; RNF6; rlim-a; RLIM; RB1; TAL1; LHX2; LMO3; SSBP4; SSBP2; TOLLIP; CTDSP1; LHX3; SSBP1; ISL1; LMX1A; ESR1; TCF3; SP1; CBFA2T3;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-LDB1 (ARP74027_P050-FITC) antibody
Blocking Peptide For anti-LDB1 (ARP74027_P050-FITC) antibody is Catalog # AAP74027
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDB1
Uniprot ID Q86U70
Purification Affinity Purified
Gene Symbol LDB1
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com