| Product Number |
ARP73918_P050 |
| Product Page |
www.avivasysbio.com/bicc1-antibody-n-terminal-region-arp73918-p050.html |
| Name |
BICC1 Antibody - N-terminal region (ARP73918_P050) |
| Protein Size (# AA) |
880 amino acids |
| Molecular Weight |
96kDa |
| NCBI Gene Id |
80114 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
BICC, CYSRD |
| Peptide Sequence |
Synthetic peptide located within the following region: AAQSDPGSNSERSTDSPVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes an RNA-binding protein that is active in regulating gene expression by modulating protein translation during embryonic development. Mouse studies identified the corresponding protein to be under strict control during cell differentiation and to be a maternally provided gene product. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BICC1 (ARP73918_P050) antibody |
| Blocking Peptide |
For anti-BICC1 (ARP73918_P050) antibody is Catalog # AAP73918 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BICC1 |
| Uniprot ID |
Q9H694-2 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BICC1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human MCF7 Whole Cell
 | Host: Rabbit
Target Name: BICC1
Sample Type: MCF7 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
