CDH6 Antibody - N-terminal region : FITC (ARP73880_P050-FITC)

• Product Number: ARP73880_P050-FITC
• Name: CDH6 Antibody - N-terminal region : FITC (ARP73880_P050-FITC)
• Protein Size (# AA): 663 amino acids
• Molecular Weight: 72kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 1004
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: cadherin 6
• Alias Symbols: CAD6, KCAD
• Peptide Sequence: Synthetic peptide located within the following region: VIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: This gene encodes a member of the cadherin superfamily. Cadherins are membrane glycoproteins that mediate homophilic cell-cell adhesion and play critical roles in cell differentiation and morphogenesis. The encoded protein is a type II cadherin and may play a role in kidney development as well as endometrium and placenta formation. Decreased expression of this gene may be associated with tumor growth and metastasis.
• Protein Interactions: CDH9; CDH7; CDH10; CDH18; CDH19; CDH6; CTNNB1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-CDH6 (ARP73880_P050-FITC) antibody is Catalog # AAP73880
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CADH6
• Uniprot ID: P55285-2
• Protein Name: cadherin-6
• Purification: Affinity Purified
• Gene Symbol: CDH6
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: