FHIT Antibody - C-terminal region : FITC (ARP73859_P050-FITC)

Data Sheet
 
Product Number ARP73859_P050-FITC
Product Page www.avivasysbio.com/fhit-antibody-c-terminal-region-fitc-arp73859-p050-fitc.html
Name FHIT Antibody - C-terminal region : FITC (ARP73859_P050-FITC)
Protein Size (# AA) 147 amino acids
Molecular Weight 16kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 2272
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols FRA3B, AP3Aase
Peptide Sequence Synthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.
Protein Interactions FHIT; REL; MDM2; UBC; RAB40B; TRIM23; LEF1; CTNNB1; UBE2I; SRC; GSN; HSPD1; FDXR;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-FHIT (ARP73859_P050-FITC) antibody
Blocking Peptide For anti-FHIT (ARP73859_P050-FITC) antibody is Catalog # AAP73859
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human FHIT
Uniprot ID P49789
Protein Accession # XP_005265010
Purification Affinity Purified
Gene Symbol FHIT
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com