EYA4 Antibody - N-terminal region (ARP73849_P050)

• Product Number: ARP73849_P050
• Name: EYA4 Antibody - N-terminal region (ARP73849_P050)
• Protein Size (# AA): 452 amino acids
• Molecular Weight: 49kDa
• NCBI Gene Id: 2070
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: CMD1J, DFNA10
• Peptide Sequence: Synthetic peptide located within the following region: DTFTGSVITSSGYSPRSAHQYSPQLYPSKPYPHILSTPAAQTMSAYAGQT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator through its protein phosphatase activity, and it may be important for eye development, and for continued function of the mature organ of Corti. Mutations in this gene are associated with postlingual, progressive, autosomal dominant hearing loss at the deafness, autosomal dominant nonsyndromic sensorineural 10 locus. Defects in this gene are also associated with dilated cardiomyopathy 1J. Three transcript variants encoding distinct isoforms have been identified for this gene.
• Protein Interactions: SIX1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-EYA4 (ARP73849_P050) antibody is Catalog # AAP73849
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human EYA4
• Uniprot ID: O95677-3
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: EYA4
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: EYA4
  Sample Type: Hela Whole Cell lysates
  Antibody Dilution: 1.0ug/ml