Product Number |
ARP73821_P050-FITC |
Product Page |
www.avivasysbio.com/dffb-antibody-c-terminal-region-fitc-arp73821-p050-fitc.html |
Name |
DFFB Antibody - C-terminal region : FITC (ARP73821_P050-FITC) |
Protein Size (# AA) |
338 amino acids |
Molecular Weight |
37kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
1677 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
CAD, CPAN, DFF2, DFF40, DFF-40 |
Peptide Sequence |
Synthetic peptide located within the following region: LRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene but the biological validity of some of these variants has not been determined. |
Protein Interactions |
DFFA; UBC; NUBP1; MARCKS; APP; CAND1; COPS5; CUL1; CUL2; CUL5; NEDD8; CIDEB; DFFB; TOP2A; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-DFFB (ARP73821_P050-FITC) antibody |
Blocking Peptide |
For anti-DFFB (ARP73821_P050-FITC) antibody is Catalog # AAP73821 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DFFB |
Uniprot ID |
O76075 |
Protein Accession # |
NP_004393 |
Purification |
Affinity Purified |
Gene Symbol |
DFFB |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|